SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021325 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021325
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.97e-79
Family BAR domain 0.00000000133
Further Details:      
 
Domain Number 2 Region: 284-347
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-23
Family SH3-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021325   Gene: ENSNLEG00000017566   Transcript: ENSNLET00000022408
Sequence length 352
Comment pep:novel supercontig:Nleu1.0:GL397279.1:24084227:24317137:-1 gene:ENSNLEG00000017566 transcript:ENSNLET00000022408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
MRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL
EERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH
Download sequence
Identical sequences A0A2I2Y4S8 A0A2I3HW13 A0A2I3SZG1 A0A2J8XI81 F7IB79 Q99962
ENSNLEP00000021325 ENSPTRP00000035569 ENSP00000369981 ENSP00000369981 ENSP00000369981 gi|4506931|ref|NP_003017.1| hso002002785.1 ENSCJAP00000023303 ENSPTRP00000035569 9598.ENSPTRP00000035569 9606.ENSP00000369981 ENSGGOP00000007517 NP_003017.1.87134 NP_003017.1.92137 XP_003260449.1.23891 XP_018889592.1.27298 XP_021530995.1.9421 XP_520501.3.37143 ENSCJAP00000023293 ENSGGOP00000007517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]