SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021658 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021658
Domain Number 1 Region: 58-255
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-37
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 295-361
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000251
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 504-612
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000113
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 4 Region: 710-782
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000408
Family VWC domain 0.022
Further Details:      
 
Domain Number 5 Region: 455-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000219
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 617-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000149
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 362-419
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000209
Family VWC domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021658
Domain Number - Region: 420-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00489
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 793-830
Classification Level Classification E-value
Superfamily FnI-like domain 0.0105
Family VWC domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021658   Gene: ENSNLEG00000017825   Transcript: ENSNLET00000022750
Sequence length 838
Comment pep:novel supercontig:Nleu1.0:GL397264.1:35303318:36252201:1 gene:ENSNLEG00000017825 transcript:ENSNLET00000022750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMDVILVVWFCVCTARTAEDMKPPVLSLIWSTRVLKSLLQQSLQGVVGFGMDPDLQMDI
ITELDLVNTTLGVAQVSGMHNASKAFLFQDIEREIHAAPHVSEKLIQLFRNKSEFTFLAT
VQQKPSTSGVILSIRELEHSYFELESSGLRDEIRYHYIHNGKPRTEALPYRMADGRWHKV
ALSVSASHLLLHVDCNRIYERVIDPPDTNLPPGINLWLGQRNQKHGLFKGIIQDGKIIFM
PNGYITQCPNLNRTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYAETRLSQLENCHCEKT
CQVSGLLYRDQDSWVDGDHCRNCTCKSGAVECRRMSCPPLSCSPDSLPVHIAGQCCKVCR
PKCIYGGKVLAEGQRILTKSCRECPSGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGH
NFCAEGPKCGENSECKNWNTKATCECKSGYISVQGDSAYCEDIDECAAKMHYCHANTVCV
NLPGLYRCDCVPGYIRVDDFSCTEHDECGSGQHNCDENAICTNTVQGHSCTCKPGYVGNG
TICRAFCEEGCRYGGTCVAPNKCVCPSGFTGSHCEKDIDECSEGIIECHNHSRCVNLPGW
YHCECRSGFHDDGTYSLSGESCIDIDECALRTHTCWNDSACINLAGGFDCLCPSGPSCSG
DCPHEGGLKRNGQVWTLKEDRCSVCSCKDGKIFCRRTACDCQNPSADLFCCPECDMRVTS
QCLDQNGHKLYRSGDNWTHSCQQCRCLEGEVDCWPLTCPNLSCEYTAILEGECCPRCVSD
PCLADNIAYDIRKTCLDSYGVSRLSGSVWTMAGSPCTTCKCKNGRVCCSVDFECLQNN
Download sequence
Identical sequences ENSNLEP00000021658 ENSNLEP00000021658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]