SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021850 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021850
Domain Number 1 Region: 347-607
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-56
Family YWTD domain 0.0000000163
Further Details:      
 
Domain Number 2 Region: 124-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 216-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 4 Region: 42-80
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 5 Region: 184-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000825
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 6 Region: 79-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000942
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 7 Region: 258-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000156
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 8 Region: 4-39
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000113
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 299-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000124
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 10 Region: 618-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000304
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021850   Gene: ENSNLEG00000017986   Transcript: ENSNLET00000022953
Sequence length 886
Comment pep:novel supercontig:Nleu1.0:GL397296.1:85078:166215:1 gene:ENSNLEG00000017986 transcript:ENSNLET00000022953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAKECEKDQFQCRNERCIPSVWRCDEDDDFSDHSDEDDCPKKTCADSDFTCDNGHCIHER
WKCDGEEECPDGSDESKATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAD
CATLCAPHEFQCGNRSCLAAVFVCDGDDDCGDGSDERGCADPACGPREFRCGGDGGGGGG
ACIPERWFACRSGECVHLGWRCDGDRDCKDKSDEADCPLGTCRGDEFQCGDGTCVLAIKR
CNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFECTCPAGFQLLDQKTCGDI
DECKDPDACSQICVNYKGYFKCECYPGYEMDLLTKNCKAAAGKSPSLIFTNRHEVRRIDL
VKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKASDPKEQEVLIDEQLH
SPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRCTLFSRNLSEPRAIAVDPLRGFMYWS
DWGDQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFSGGN
RKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNPHDIVI
FHELKQPRAPDACELSVQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRA
PQSTSTTTLASTKTRTVPATTRAPGTTVHRSTYQNHSTETPSLAAAVPSSVSVPRAPSVS
PSTLSPATSNHSQHYGNEDSKMGSTVTAAVIGIIVPIVVIALLCMSGYLIWRNWKRKNTK
SMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRPLWAEPCLGETRELEDPA
PALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP
Download sequence
Identical sequences ENSNLEP00000021850 ENSNLEP00000021850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]