SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022201 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022201
Domain Number 1 Region: 92-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000221
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022201   Gene: ENSNLEG00000018297   Transcript: ENSNLET00000023322
Sequence length 255
Comment pep:novel supercontig:Nleu1.0:GL397353.1:7152296:7153063:-1 gene:ENSNLEG00000018297 transcript:ENSNLET00000023322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLATSFVLGSLGLAFYLPLVVTTPKTLAIPEKLQEAVGKVIINATTCTVTCGLGYKEE
TVCEVGPDGVRRKCQTQRLECLTNWICGMLHFTILIGKEFELSCLSSDILEIGQEAFRFT
WRLARGIISTDDEVFKPFRANSHFVKFKYAQEYDSGTYRCDVQLLKNLRLVKRLYFGLRV
LPPNLVNLNFHQSLTEDQKLIDEGLEVNLDSYSKPHHPKWKKKVASALGIGIASGVVGGV
LVRIVLCVLRGGLQQ
Download sequence
Identical sequences G1S9L0
ENSNLEP00000022201 ENSNLEP00000022201 XP_003273211.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]