SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022781 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022781
Domain Number 1 Region: 17-163
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.09e-37
Family Dual specificity phosphatase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022781   Gene: ENSNLEG00000018918   Transcript: ENSNLET00000023943
Sequence length 188
Comment pep:novel supercontig:Nleu1.0:GL397272.1:2979041:2979607:-1 gene:ENSNLEG00000018918 transcript:ENSNLET00000023943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTL
YEDIQYLQVPVADAPNSRLCDFFDSIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLM
KYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPMGMIPDIYEK
EVRLMIPL
Download sequence
Identical sequences XP_003258133.1.23891 XP_012363547.1.23891 ENSNLEP00000022781 ENSNLEP00000022781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]