SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022789 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022789
Domain Number 1 Region: 637-782
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.12e-45
Family Toll/Interleukin receptor TIR domain 0.0000000561
Further Details:      
 
Domain Number 2 Region: 45-166,354-554
Classification Level Classification E-value
Superfamily RNI-like 2.04e-34
Family Cyclin A/CDK2-associated p19, Skp2 0.038
Further Details:      
 
Domain Number 3 Region: 121-291
Classification Level Classification E-value
Superfamily RNI-like 0.000000149
Family 28-residue LRR 0.024
Further Details:      
 
Domain Number 4 Region: 592-653
Classification Level Classification E-value
Superfamily Fumarate reductase respiratory complex transmembrane subunits 0.0000392
Family Fumarate reductase respiratory complex cytochrome b subunit, FrdC 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022789   Gene: ENSNLEG00000018926   Transcript: ENSNLET00000023951
Sequence length 784
Comment pep:novel supercontig:Nleu1.0:GL397272.1:19837735:19840234:1 gene:ENSNLEG00000018926 transcript:ENSNLET00000023951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHSLWMVWVLGVIISLSKEESSHQASLSCDRNGSCKGSSGSLNSIPSGLTEAVKSLDLS
NNRITYISNSDLQRCVNLQALVLTANGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF
KPLSSLTFLNLLGNPYKSLGETSLFSHLTKLRILRVGNIDTFTKIQRKDFAGLTFLEELE
IDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFS
ELSTGETNSLIKKFTFRNVKITDESLFQILKLLNQISGLLELEFDDCTLNGVGNFRASDD
DRVIDPGKVETLTIRRLHIPRFYLFYDLRTLYSLTERVKRITVENSKVFLVPCSLSRHLK
SLEYLDLSENLMVEEYLKNSACEDGWPSLQTLILRQNHLASLEKTGETLLTLKNLTNLDI
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLLQLK
ELYISRNKLMTLPDASLLPTLLVLKISRNTITTFSKEQLDSFHTLKTLEAGGNNFICSCE
FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQRVQDVRLSVSECHRTALVSGICCALFL
LILLTAVLCHHFHGLWYMKMMWAWLQAKRKPRKAPSRDICYDAFVSYSEQDAYWVENLMV
QELENFNPPFRLCLHKRDFIPGKWIIDNIIDSIERSHKTVFVLSENFVKSEWCKYELDFS
HFRLFDENNDAAILVLLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRA
AIKS
Download sequence
Identical sequences G1SB95
XP_003257902.1.23891 XP_012363424.1.23891 XP_012363425.1.23891 XP_012363426.1.23891 ENSNLEP00000022789 ENSNLEP00000022789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]