SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023017 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023017
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily Immunoglobulin 8.69e-48
Family V set domains (antibody variable domain-like) 0.0000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023017   Gene: ENSNLEG00000019171   Transcript: ENSNLET00000024196
Sequence length 97
Comment pep:novel supercontig:Nleu1.0:GL397565.1:526853:527143:-1 gene:ENSNLEG00000019171 transcript:ENSNLET00000024196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVQLVQSGPEVKKPGASVKVSCKASGYTFTSSAMQWVRQAPGQGLEWMGWIIVGNGNTNY
AQKFQGRVTITRDTSTSTAYMELSSLRSEDTAVYYCA
Download sequence
Identical sequences ENSNLEP00000023017 ENSNLEP00000023017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]