SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374309098|ref|YP_005055528.1| from Granulicella mallensis MP5ACTX8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374309098|ref|YP_005055528.1|
Domain Number 1 Region: 110-170
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.00000000024
Family Sigma4 domain 0.01
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 0.000000000283
Family Sigma2 domain of RNA polymerase sigma factors 0.009
Further Details:      
 
Weak hits

Sequence:  gi|374309098|ref|YP_005055528.1|
Domain Number - Region: 370-403
Classification Level Classification E-value
Superfamily TPR-like 0.00996
Family Tetratricopeptide repeat (TPR) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374309098|ref|YP_005055528.1|
Sequence length 423
Comment putative ECF subfamily RNA polymerase sigma-24 subunit [Granulicella mallensis MP5ACTX8]
Sequence
MSDIHKAIEAVWKIESTRLIAGIARVTRDIGIAEELAQDALVAALERWPEEGIPEKPAAW
LMTAAKRRAIDSLRRGRMLEQKHGEIARELEFQQQRLGEAMDQALDQVIDDDVLRLIFTA
CHPVLTVEGRIALTLRLIGGLTTAEIARAFLVPEKTMGQRIFRAKKTLAEAHVPFEIPRG
DELRRRLESALSVVYLIFNEGYTATSGDTWMREELCNDALRLGRILASLLPGESEVHGLL
ALMELQASRTAARKGQNGKAVLLLEQDRSLWDHIQIQRGMAALHSAQKLGGGASSYTLQA
AIVACHARARTAADTDWERIVLLYDALLQIRPSPIVGLNRAVAVGMAQGPTAGLATLDAL
DPDPALTGYHLLPSVRGDLLLKLGRFSEAREEIQRAIAMTENRREQELLSEKLKQIPETK
QDA
Download sequence
Identical sequences G8NYT5
WP_014263382.1.98070 gi|374309098|ref|YP_005055528.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]