SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374312928|ref|YP_005059358.1| from Granulicella mallensis MP5ACTX8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374312928|ref|YP_005059358.1|
Domain Number 1 Region: 10-101
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 4.51e-20
Family Sigma2 domain of RNA polymerase sigma factors 0.0043
Further Details:      
 
Domain Number 2 Region: 118-179
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.00000000000318
Family Sigma4 domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374312928|ref|YP_005059358.1|
Sequence length 184
Comment ECF subfamily RNA polymerase sigma-24 subunit [Granulicella mallensis MP5ACTX8]
Sequence
MILSEGYSLDLLSAQTAGSEIDLAALVEAYSALLFRVAHSVLRNKAEAEDVVQDAFVRVL
EHRRTLPGVRDMRVWLVRVAWNLSLDRRRRIRPEQMDEIFAESLVAHHMPADVALNEAQR
MKAVFREIERLPKAERQVLLLSALEELDTAEMAQVVSRSESAVRALLFRARSRLRTRLEK
GGNA
Download sequence
Identical sequences G8NPZ4
gi|374312928|ref|YP_005059358.1| WP_014267199.1.98070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]