SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345430404|ref|YP_004823525.1| from Haemophilus parainfluenzae T3T1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345430404|ref|YP_004823525.1|
Domain Number 1 Region: 3-208
Classification Level Classification E-value
Superfamily CAC2185-like 7.32e-85
Family CAC2185-like 0.0000989
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345430404|ref|YP_004823525.1|
Sequence length 209
Comment hypothetical protein PARA_18390 [Haemophilus parainfluenzae T3T1]
Sequence
MSLFSKFRSAINKLQRKAINKTFQQRLTNQGMSVISANCVGAFILHDLNQPFNSPFVNLY
LDPSDFVRYLQNIAFYQAQPLQFIQTEKPYPVGLLGDLKVHFMHYHSEQEAQEKWEARSQ
RLNLDNLFIMMTDKDGGKGAKYEDLQAFDNLPYPNKVVFTHKPYPELKSAFYIKGFENEG
EVGDLFTFSGWNGEKYYDQFDYVSWFNQK
Download sequence
Identical sequences E1W6E5
gi|345430404|ref|YP_004823525.1| WP_014065555.1.58168 WP_014065555.1.68312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]