SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|344210597|ref|YP_004794917.1| from Haloarcula hispanica ATCC 33960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344210597|ref|YP_004794917.1|
Domain Number 1 Region: 4-213
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000058
Family Bacteriorhodopsin-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344210597|ref|YP_004794917.1|
Sequence length 236
Comment rhodopsin-like protein [Haloarcula hispanica ATCC 33960]
Sequence
MISGSAVYEIAAVLLAVAAVVLSGWLRRIPSSHRHYCYPVVAVVGISAVTTALTAAGVLP
VPGSQLTVPNIVDDFVAYTVLWTLTVAIAGASRRTLAVAAAIPAVQVIAFNGGTIVGGAI
GLVGFGVLVIGQLLLAYLLLGPVWRRAADLPDDQRLLHWKSRNLLLFLIGMLIAYSLLAV
ADVFDPFVLTVISEYMGLLIRVGFAGFLFANVDAIAVDRTGFADVASESAGAQHAD
Download sequence
Identical sequences G0HSA3
gi|344210597|ref|YP_004794917.1| WP_014039303.1.67629 WP_014039303.1.92404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]