SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|344211122|ref|YP_004795442.1| from Haloarcula hispanica ATCC 33960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344211122|ref|YP_004795442.1|
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.58e-40
Family GHMP Kinase, N-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 189-304
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.38e-30
Family Mevalonate kinase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344211122|ref|YP_004795442.1|
Sequence length 327
Comment mevalonate kinase [Haloarcula hispanica ATCC 33960]
Sequence
MVTSSAPGKVYLFGEHAVVYGEPAVPCAIERRVHVTATEIDEGLRIHANDLQLDGFTVEY
TGDGESHPDVDVAESLVEAGMGYVNEAVAQARDAADAPEAGFEISVEGDIPLGAGLGSSA
ALVVAAIDAATRELGVELPASEIADRAYQVEHEVQDGQASRADTFCSAMGGAVRVEGNDC
RRLDGIDTLPFVIGYDGGAGDTGALVAGVRTLRDEYDFAADTVAAIGDIVREGEAVLETG
DYERLGELMDFNHGLLSALGVSSRSLDSMVWAARDADAHGAKLTGAGGGGCIVALDETDD
ALTALKYTPGCEDVFRAELDTDGVRQE
Download sequence
Identical sequences G0HVV4 V5TJV4
WP_014039763.1.67629 WP_014039763.1.92404 gi|564289126|ref|YP_008875356.1| gi|344211122|ref|YP_004795442.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]