SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|344211693|ref|YP_004796013.1| from Haloarcula hispanica ATCC 33960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344211693|ref|YP_004796013.1|
Domain Number 1 Region: 834-885
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000049
Family Type I dockerin domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|344211693|ref|YP_004796013.1|
Sequence length 888
Comment putative cell surface protein [Haloarcula hispanica ATCC 33960]
Sequence
MVDFTRRQVLSQSVAAALGASVIGVASGEEVEETDTPGAPSVAGSLKRFSTTAFGAEVTG
PFVFEDGSLLYSLQHPEGENPEPFGRAAVGYFNGFQFKFDGSNDDFPEVGVPDTEEKQRQ
VRSAAGDYEILVQGREPINGGAERLGVVQTPDGTDITQENFAGTQYGGAATNPDCNQFVP
SNDEGTEGYLFTNWENSPGCVSRVPLSQDENGEWSADTGNAMNLTNTDSLREHGGTRINC
YGDLSPWETMISAEENYAHPRVSLTATVSDIVEAGSGEGLIGGCQFWNRPNPSEISGAIE
SYAESGDLDENFGPQGYWALTGVEFLAYYLGAERDDQGDGENLATTLLDDVYPNPYRYGY
FVDFREPTADEPEAVKYYVMGRASWEAPDIEGDQRTVYGCSDGDSKGIYKFVADEPIPEY
DDPMDVAGTLYAPKITNDAANAAEAGERNSPAQTPLEIEWIELGHATNGEVESWVAEYDD
VTQADYLSAHADWEDGDEVTEAAIKEADLSVIENGNQNYITNEDIVEWAEQYEANGPDGV
DEDLRRVPFLETRAAAKEIGASIEFNKAEGVDSVDDSQPGDFIYFGISEFNDALADDEGD
IQMDRVDGGVVYRGVLESDYNVSTLEPVITGPDFTDSPEDANDALRNIDNVYTMRDGRVI
CCEDGFGGPARSYPNDGLYVYQPNVVVSANSAAVGSGSTGSVPLTASSLPAGFSGARLTV
SVSNPEIASITGVSFPDALGLTESSISDDGSSATIRVADVNTNVQSGAMDVPLATLDVRA
NGGGTTDLTVSIEQMDDENGNAIEAEVRNGIVVGGPKTVVGDAAPTDPDGDGHFEDLNGN
GRLDYEDVQVLFSNMDSDSIQLNTGAYDFNENGKIDFADVTALYEEVN
Download sequence
Identical sequences G0HQM9 V5TMN6
gi|564289673|ref|YP_008875928.1| gi|344211693|ref|YP_004796013.1| WP_014040263.1.67629 WP_014040263.1.92404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]