SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|344213222|ref|YP_004797542.1| from Haloarcula hispanica ATCC 33960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344213222|ref|YP_004797542.1|
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.29e-35
Family YigZ N-terminal domain-like 0.00035
Further Details:      
 
Domain Number 2 Region: 136-198
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000146
Family YigZ C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|344213222|ref|YP_004797542.1|
Sequence length 200
Comment hypothetical protein HAH_2980 [Haloarcula hispanica ATCC 33960]
Sequence
MTDSYLTVPGRGEARFEVRGSEFIGHVAPAATVEAAEAFVDAVSEEYADATHNVPAYRVR
SDPFREYSSDDGEPSGSAGDPALNVLQQRDIENAVAVVTRYYGGTNLGVGGLASAYSRAV
KEGVDDAGVVEEVPHEQFTVTVAYDDSGSVRSLLESAGVEFAADYEAEVVFEVRVPTAEG
SDLRDRIRSATSGRAAIELA
Download sequence
Identical sequences A0A0B5GYZ0 A0A165LIC9 G0HTI8 V5TQP5
gi|564291136|ref|YP_008877470.1| WP_014041592.1.13069 WP_014041592.1.27393 WP_014041592.1.67629 WP_014041592.1.92404 WP_014041592.1.92869 gi|344213222|ref|YP_004797542.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]