SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|344209742|ref|YP_004785919.1| from Haloarcula hispanica ATCC 33960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344209742|ref|YP_004785919.1|
Domain Number 1 Region: 481-652
Classification Level Classification E-value
Superfamily vWA-like 4.45e-31
Family Integrin A (or I) domain 0.0081
Further Details:      
 
Domain Number 2 Region: 107-158
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000706
Family Type I dockerin domain 0.0037
Further Details:      
 
Domain Number 3 Region: 650-741
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000929
Family TSP type-3 repeat 0.0093
Further Details:      
 
Weak hits

Sequence:  gi|344209742|ref|YP_004785919.1|
Domain Number - Region: 840-879
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0017
Family TSP type-3 repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|344209742|ref|YP_004785919.1|
Sequence length 1684
Comment putative calcium-binding protein [Haloarcula hispanica ATCC 33960]
Sequence
MTVGPVSGMMTGTGAGPLQTAGNDIPGTSAGNQAVTTAGNEPTRTQSTQTPTSTAGNQAT
GPLSTSWNGSTEPNASAIEQLAPRENDSHPYPLVGDNQPTDPDGDGLYEDVNGDGAVNIV
DVDALSRHLGSTAAGANWSAYDYTGDNRTDVGDIQWLFVATRSTPSNDTDGDGLPDAYER
NVTKTDPRVADSDGDAVIDGAEDWDNDTLPAYREYRLGTDPRSNDTDGDRLPDGVESRLQ
SVDPTDPDTDDDGVQDSAADPDNDSLSIYNETVAGTLSNDPDTDGDGLLDGTEVHQLGTD
PLKADTDSDGLPDGAEVRLGTDPLVADSNDNGVSDGEESYTTTAANETLGVTLSLTGNGD
IGNGTTIAPQDDPRFNTSRVGNMSASPVVKLNSEQEFSSANVTLAYNETGVENESQDLAV
FTYDPEAGIFVPLNSTVDATNNTATAETTHFSTFAVFDISNWATTYNATEPVRQTDDDGV
KPVDVVMLLDASGSMKGEDPDRLAKDAAQRFTGSLLETDRAAVIEFDNFGRVKQPLTSNH
TAVNRSIRDVEYEGGNGGTDFASISAANDHFAEQSSPNRTKIIIFLTDGKSKYSDGVAEA
EQAAEQNITIYPIGFGGATRDQLSAIATATGGEVNFVDDAAGLPTVFSRVANTTTEINDT
DGDGLSDEMEREGVILGGPNGDRVTTDPKSADTDGDGLSDSREIGQYTEVSYRGRTASYY
NHLANPRQVDTDGDNLTDAEEVAGWEVQRTQSANASKGYLNVSRPDPSKRLLRSYLRSLY
RGETESYQPQISRGPDSSSSKALAITIAEQTDIDVSTLNETGHGPSPNGSYLTNITATSD
PLQPDTDHDGLADNVEHLRGTDPSRADTDGDGISDQTEFTSGTAPVLFDHRAPTVTIESI
RTKRIKNTTKVIVRQQGTTKTVRPENIKTTDSTSSGAILVAKYRYTVRLRAHDPSGVSKL
VVKPDCQYLARRAGSNLGSLMESACQGDGETIRFDNETTTSYRRVEFTVRTPIDKAGVFA
FQEFSQFFESFPVAVTAVDSNRNSRSSDYTSPGAIPELAKTAADHPATGERTEDRVIEEI
AYRSGGVWGVRQSALDLSYFLSHPWTAVTWLGNIDRLPDAALRAPETLPSAARNLQDRQN
PFDRRTETENYKLYGQNWLVGYGSGVAGSELSIGLATGGGSTVSKAAKLRKVTDTVGDAG
TAARGWTFHRSVRMASTISKGTDIKPAGTRRALGRVTIPERVRHAQRLNSPRWTRLIESL
PERATGPSRTERVSRTMRRTGDDGRQLMLQLHNSGDQRALETFIAMDETPGTQRALVRAS
REDPDVSKQDLSEALRRYDELDANERSEFDRFVEASGDNGIKFASDLDTDQAREFFSSAC
RRSPSIGAAPRPRSDRFYSIKTIGGSSLAGCGDDLTDAEETRYYSRIADVAAENEDISAG
EIFEQVSDVDDATRREAVKRLLADSGEDGVRLTRNIDSDAQEIFFDLGRNDRIDGFDDFD
EWRSAIANAEDVDAAEAGRYAERVDSAATRDNIDDVHEILDETTPRTDAVAGESGEAASA
IRYADDGAEVEMEPGQTDAYDMSVEEGGTTEYVEVKTRADNDVDYNYINTQISEMNKKHN
NALDDPELDVSENAQVLEIRTRAPSDELSSAQTAAENVLDDRVDAQVDEIRLVAENGDTV
TVEP
Download sequence
Identical sequences G0HYN4
gi|344209742|ref|YP_004785919.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]