SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|344211280|ref|YP_004795600.1| from Haloarcula hispanica ATCC 33960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344211280|ref|YP_004795600.1|
Domain Number 1 Region: 148-221
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000000314
Family Transglutaminase, two C-terminal domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|344211280|ref|YP_004795600.1|
Sequence length 497
Comment hypothetical protein HAH_0994 [Haloarcula hispanica ATCC 33960]
Sequence
MRHGVAVLACLVVVGSLPLSVAGASVNASISNVEVSPSSPAPGETVTFDTTVRNLESSDA
PLEINDIAIRKSGGRGITEYERVSNLGSIAPGSTLEVPLTASFDSSGSKDLRVIVYGRDR
GTGENVELRYPVKLNVKERHPQVDITANDSVAGVESTGEVTVANGLDTQITNVEVVVEGD
GVEMTKSRTVRSSVAQNGSITAPFRFRPESAGEHSLTATISYTVDGDTTRNTTRTTVIES
DPLRNSVELDTTAVGSGTDRALRVAVSNGGNAPLSDVMISATSENASFQRVLLENISAST
TRQVRLNATMDEPRADVTVTANYELGTETEQTTTETTLRSVPGTIDLTGLDVVRQGGRLQ
ISGSASNVGSTDADSVLVSVVNTETVTPATPNRDYFVGTVPASDFVSFDVYARTEGNVTS
VPLEVTYLVDDTRKRQTFDVNIDRMGGMAPQPEQDGDSEGGDQNSMLPVFVAGGLALLVV
VGVLVRRYRRGDDDIEV
Download sequence
Identical sequences G0HWR9 V5TLK1
WP_014039907.1.67629 WP_014039907.1.92404 gi|344211280|ref|YP_004795600.1| gi|564289273|ref|YP_008875510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]