SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386713553|ref|YP_006179876.1| from Halobacillus halophilus DSM 2266

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|386713553|ref|YP_006179876.1|
Domain Number - Region: 4-59
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0502
Family Cytochrome c3-like 0.087
Further Details:      
 
Domain Number - Region: 52-91
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0628
Family MED7 hinge region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386713553|ref|YP_006179876.1|
Sequence length 95
Comment hypothetical protein HBHAL_2247 [Halobacillus halophilus DSM 2266]
Sequence
MEGTCELCFRTPVKTTEHHLIPRQHGGAMGVTVWLCGACHRQIHALFTNEELANFYHTLE
RLREHPDMEKYLSWIKKQDPQKEVTTRKSNRRRRR
Download sequence
Identical sequences I0JKD1
gi|386713553|ref|YP_006179876.1| WP_014642502.1.51524 WP_014642502.1.59131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]