SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386714018|ref|YP_006180341.1| from Halobacillus halophilus DSM 2266

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|386714018|ref|YP_006180341.1|
Domain Number - Region: 24-110
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000262
Family MgtE N-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386714018|ref|YP_006180341.1|
Sequence length 156
Comment hypothetical protein HBHAL_2718 [Halobacillus halophilus DSM 2266]
Sequence
MAKPITSIKKYEASREEQIEKDFEEVKAAIADNKTAILKGIDLLKALEESETLDAATAFT
YKRKEILANIVEEINRDMYTGILENIPEIVYLLGDLDLKTVRDVTSKLNQGMEEMNTAAS
SKEKTSVLDLAKALKDPEINRSITMLMSFLKGMGRN
Download sequence
Identical sequences I0JLP7
WP_014642961.1.51524 WP_014642961.1.59131 gi|386714018|ref|YP_006180341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]