SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386714335|ref|YP_006180658.1| from Halobacillus halophilus DSM 2266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386714335|ref|YP_006180658.1|
Domain Number 1 Region: 103-185
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000196
Family MgtE N-terminal domain-like 0.0061
Further Details:      
 
Weak hits

Sequence:  gi|386714335|ref|YP_006180658.1|
Domain Number - Region: 64-112
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00314
Family HBL-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386714335|ref|YP_006180658.1|
Sequence length 195
Comment hypothetical protein HBHAL_3037 [Halobacillus halophilus DSM 2266]
Sequence
MAKKITDKQQGTKLQWFFFVIIIPIVFAITLAWIVLTLLGVNVIEQADKYVSKVPGMSQS
ASAPEEENTKSNNKELQTSLDAKNEEIELLEEELSAKQTEIDELEQKVVKLEADVKSAQE
VKEEKPENEKVMNMAASFQQMEPEEAAPIVENMSQDLAIQVLENVASEERGLIFGQMSPE
AAAEIAGEIINSSEN
Download sequence
Identical sequences I0JML4
gi|386714335|ref|YP_006180658.1| WP_014643276.1.51524 WP_014643276.1.59131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]