SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386712820|ref|YP_006179142.1| from Halobacillus halophilus DSM 2266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386712820|ref|YP_006179142.1|
Domain Number 1 Region: 20-209
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-58
Family BPHL domain 0.00000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386712820|ref|YP_006179142.1|
Sequence length 210
Comment hypothetical protein HBHAL_1493 [Halobacillus halophilus DSM 2266]
Sequence
MKGEILLFKKLASDALGLSDIGKIINKEDFDKTQSDDFVLTEDEEKIFFLIKSKSDEYCF
TNRALIHLDGEKASSSKRNILRYDYYKHHISNPSIETAGTIDLDLEIKFTMGNKVFSIDI
AKDEGEAIADLYKSLVAISHIQEENRLYSDFARDSLGTASSLIKDNRFHDHDISKEFEQA
ANFAYGWYEQKHRENTQKDFKEVFEKYIHN
Download sequence
Identical sequences I0JI97
gi|386712820|ref|YP_006179142.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]