SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386715732|ref|YP_006182056.1| from Halobacillus halophilus DSM 2266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386715732|ref|YP_006182056.1|
Domain Number 1 Region: 175-446
Classification Level Classification E-value
Superfamily Subtilisin-like 1.83e-86
Family Subtilases 0.00000314
Further Details:      
 
Domain Number 2 Region: 471-549
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000706
Family Collagen-binding domain 0.0092
Further Details:      
 
Weak hits

Sequence:  gi|386715732|ref|YP_006182056.1|
Domain Number - Region: 572-627
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0196
Family Collagen-binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386715732|ref|YP_006182056.1|
Sequence length 872
Comment alkaline serine protease, subtilase family [Halobacillus halophilus DSM 2266]
Sequence
MKKRTRYSITSVMISLTLVAPTLTGIAPSSSVQAEERMKQIPVEEITKKEAQTSKPEEGS
SFKKDDRPVKQVHKKESSKKSKQVEEVDLKDVHNRGILIQVKESSSFSPQKYEVNEEPLS
EALKRHNFLLLEVEEGADYHHVLQQLNEDPAVLTADPDYISESSYVPSDPKYSGQYQYDD
MNMEKAWNVTRGSSDTTVAVLDTGVYKDHEDLQGVVLPGYDFVNNDSNPNDNHGHGTHIA
GLIAANFNDRGIAGLAPDTKILPVKVGNDEARFSDSDVLSGIYYAIDQGVDVINMSFGAY
HKSAAEERALWKAYNEGIVLVAAASNDGIRDAAYPASYYPVISVAATERSGYPAAFSNYG
TWIDLAAPGVFLTSTSYLGGYTSMSGTSFSAPLVSGLAAMIKGENPGWNPAEIEWAMEKH
VETPNGSRWEEEYGYGIPDGYEVITSAAVDLNDDVSDKRESSFHLEKGQRKRENLDTPND
SDWYDFRVDHPTTVSVDVTSRSDNEDLVVAVYNRYGERQVFDGEWKGSGESFTFEASPGM
YKVMVYEYYNHWSDEPYVMEVNWPDHPNKDEVVYEQEPNEKVSSATQLSYDQAAVGTFDL
NDLDYYQVDFPYSGSVDVTLASGADASHIDPELTVTAYDQEGNRQTLEAAAIQQFEQDGV
TYHTATIEGITRGPHYLMVENGTGEADRNENYVLSMEYNEKTFPDVTGTWAEPYVSYLSR
ENLMTGYPDGTFGFHDAITRAGAATMIARELDLPLKEADFPDVPSRHWGSEYIGALAEAG
ILSGYEDGTFHPNSTLTRAEMATLVVRAYDLTGESASSFPDVKAGSWAASYIDTLTANDV
ITGFPDGTYRPNQAIKRSEFAVIMAKLLSDEL
Download sequence
Identical sequences I0JRL3
gi|386715732|ref|YP_006182056.1| WP_014644669.1.51524 WP_014644669.1.59131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]