SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389846010|ref|YP_006348249.1| from Haloferax mediterranei ATCC 33500

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389846010|ref|YP_006348249.1|
Domain Number 1 Region: 47-435
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.32e-103
Family Amylase, catalytic domain 0.000000000195
Further Details:      
 
Domain Number 2 Region: 610-712
Classification Level Classification E-value
Superfamily Starch-binding domain-like 2.7e-32
Family Starch-binding domain 0.0000147
Further Details:      
 
Domain Number 3 Region: 438-524
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.01e-24
Family alpha-Amylases, C-terminal beta-sheet domain 0.00011
Further Details:      
 
Domain Number 4 Region: 528-603
Classification Level Classification E-value
Superfamily E set domains 3.5e-17
Family E-set domains of sugar-utilizing enzymes 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389846010|ref|YP_006348249.1|
Sequence length 713
Comment cyclomaltodextrin glucanotransferase [Haloferax mediterranei ATCC 33500]
Sequence
MSFDRRTFLKGLGLSAIGLAGGTGAGNDDLAFVSQAAAATPPEQTVNFADDVIYQLISDR
FRDGNPNNNPTGELASDDCSNLRKYCGGDWQGIIDKIQSGYLTDLGVSAVWISPPFENIT
AVDSDIGTSYHGYWARDFTDPNEFFGDMETFKQLVDVAHQNGIKVVIDFVPNHTSPSTSD
GELEDGALYDNGSYVAAYNDDPKSYFHHNGGTDYSSYEDQIYRNLYNLADFDHHEAYIDQ
YLKDAIKQWLDAGIDGIRVDAVAHMPPKWQKTLVDTIYDHRPVFTFGEWFLGADQSNPRY
YEFSNDSGMSLLDFRFGQEIRQVLRDFTDDWYGFRDMLQETESEHDQVIDQVPFIDNHDM
PRFTVADGDTRNTDMALAVLLTSRGTPAVYYGTEQYLTGGNDPDNRKPMPSFDTTTTAYK
VIQALTSLRSSNPALAYGDTEERWINSDVFVYEREFGDNVVLVAINRSLDWYDVSGLQTS
LPEGTYDDALGGTLDGFSTTVNTDGSIDTFSVGPQTVCVWEHTGTTAEPALGHVGPTMGQ
PGHTVVLSGDGFGSTEGSVEFGTTSASITSWSNTEIEATVPAVSGGYYDVTVTDANGAQS
DPFSGYEVLSGDQISARFVVNDATTDVGENVYVVGNVHELGDWDTDRAVGPFFNQVVHEY
PNWYYDVNLPAGTDIEFKFVKIASDGTVTWESGSNRQYTTPTDSTGEYSGTWK
Download sequence
Identical sequences I3R202
gi|389846010|ref|YP_006348249.1| WP_004057795.1.26851 WP_004057795.1.35700 WP_004057795.1.77170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]