SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389846096|ref|YP_006348335.1| from Haloferax mediterranei ATCC 33500

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|389846096|ref|YP_006348335.1|
Domain Number - Region: 18-85
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0273
Family Ribonuclease PH domain 1-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389846096|ref|YP_006348335.1|
Sequence length 89
Comment rpo operon protein [Haloferax mediterranei ATCC 33500]
Sequence
MRPAHSASLEFDYPDERRARVVERSVAVEVGEIDDARSGASVDRDGNTVVVTVEADDLVA
LRAGVNSWIRLVETAETVAAAGESRSQSA
Download sequence
Identical sequences I3R288
WP_004057621.1.26851 WP_004057621.1.35700 WP_004057621.1.77170 gi|389846096|ref|YP_006348335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]