SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389846942|ref|YP_006349181.1| from Haloferax mediterranei ATCC 33500

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389846942|ref|YP_006349181.1|
Domain Number 1 Region: 1-163
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.75e-32
Family GHMP Kinase, N-terminal domain 0.00028
Further Details:      
 
Domain Number 2 Region: 173-322
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.73e-31
Family Mevalonate 5-diphosphate decarboxylase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389846942|ref|YP_006349181.1|
Sequence length 324
Comment diphosphomevalonate decarboxylase [Haloferax mediterranei ATCC 33500]
Sequence
MKATAKAHPIQGLVKYHGMRDPEIRLPYHDSISVCTAPSHTKTTVEFLPDADEDVYVIGG
EEVEGRGAERIRDVVEHVRDLADFDHRVRLESENSFPSNIGFGSSSSGFAAAAMALAEAA
DLDLTRPEISTIARRGSSSAARAVTGAFSHLYSGMNDTDCRSERIETDLEDDLRIVAAHV
PAYKETEQAHAEAADSHMFQARMAHMHKQIDDMRDALYEADFDAAFELAEHDSLSLAATT
MTGPAGWVYWQPRTIAVFNAIRELRAEEDIPAYFSTDTGASVYINTTTEYVDRVEKVVAD
CNVETDVWEVGGPAEILDESDALF
Download sequence
Identical sequences I3R4N4
WP_004056968.1.26851 WP_004056968.1.35700 WP_004056968.1.77170 gi|389846942|ref|YP_006349181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]