SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389847569|ref|YP_006349808.1| from Haloferax mediterranei ATCC 33500

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389847569|ref|YP_006349808.1|
Domain Number 1 Region: 142-342,370-473,500-518
Classification Level Classification E-value
Superfamily Subtilisin-like 3.14e-59
Family Subtilases 0.0000756
Further Details:      
 
Domain Number 2 Region: 546-600
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000128
Family Type I dockerin domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389847569|ref|YP_006349808.1|
Sequence length 601
Comment subtilisin-like serine proteinase [Haloferax mediterranei ATCC 33500]
Sequence
MFFGNNIYDWYMLVYMEQTRRRFIKTAAAAAGGLSMATSPVVANGVRENHFLVDTRSADS
EAWREQVEIVDEADAVQFASVKGDESDLEGFGLDFAPEIEFSIEPPEVKGVSPDDVPDKL
PETGQFDATQEAEDGIPEPHPYQWSKRSQNVKALHEDGITGDGATIAIVDSGIDPDHPDL
VVDTERSGNFSLDDSIGTSDDSSHGTHCAGISAANGSRASEGGPYVVGVAPDAVLLDMKV
FPFKSSASILSAVTTAVDNGADAINLSLGPGSPVGPSVSQHLSVKSYRRVGEYARKNGAI
LIEAAGNDDTNIDEFEPQITNAGKGSQSGWVTVSATGPYSEAPSYMDAPKDLDENGNPDY
GTILPVHTPSDYTNYGPKSLDVSAPGGNAGYRGTLFDGVMSTLSPKVDNYGFVRIGPGGG
SAGLVGSGMYGTLHGTSMAAPHVTGLAALIMAEYPDAAPDQVKAHIKNTAKHIDATYSNS
NYFTDEPTDRDDYDDGMLEDPYDSKTFRGAGHIDIERAGRKSIPFPGGVEVDGQTVYPAD
PDDDGLYEDVNGDGVVDMKDAELLYQIALEDAVDSEATAFDFDGNGRFDMNDVQELIRRV
E
Download sequence
Identical sequences I3R6G1
gi|389847569|ref|YP_006349808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]