SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389848389|ref|YP_006350628.1| from Haloferax mediterranei ATCC 33500

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389848389|ref|YP_006350628.1|
Domain Number 1 Region: 11-151
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-36
Family YigZ N-terminal domain-like 0.00021
Further Details:      
 
Domain Number 2 Region: 156-217
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000259
Family YigZ C-terminal domain-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389848389|ref|YP_006350628.1|
Sequence length 218
Comment hypothetical protein HFX_2977 [Haloferax mediterranei ATCC 33500]
Sequence
MPRRQLAVMTDAYRTVAGRAEARFEVNGSEFIGYISPAETVDEAEAFVDEIEERHPDATH
NVPAYRVPAGGASSTVPGGGNVMLREYQSDDGEPTGSSGKPALNVLVQQDVRNVAVVVTR
YYGGTNLGVGGLARAYSRAVKEALDAAGIVEEIPHERFTATVDYDDSGDVRGILESTGVE
FDADYDQRVSFSVRVPVDDADGLRDRLRSATSGRVELE
Download sequence
Identical sequences gi|389848389|ref|YP_006350628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]