SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345004035|ref|YP_004806888.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345004035|ref|YP_004806888.1|
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily Vng1086c-like 6.28e-20
Family Vng1086c-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345004035|ref|YP_004806888.1|
Sequence length 73
Comment hypothetical protein [halophilic archaeon DL31]
Sequence
MKKQELIHLHGLLAEVRGAYDDSEELDCSKYEAFGVQPTSIHRSKTDHKTAVFKLAGGLT
TSFEAEQVTQAAD
Download sequence
Identical sequences G2MFW6
WP_014050296.1.75361 gi|345004035|ref|YP_004806888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]