SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345005607|ref|YP_004808460.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345005607|ref|YP_004808460.1|
Domain Number 1 Region: 1-68
Classification Level Classification E-value
Superfamily Vng1086c-like 1.2e-19
Family Vng1086c-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|345005607|ref|YP_004808460.1|
Sequence length 76
Comment hypothetical protein [halophilic archaeon DL31]
Sequence
MKKQELIHLHGLLAELQNNSDAAGEMPSDEYRELGVQPTSIHRSKTDHKAAVFALIHSIT
DEFEDGSAEPVPATAD
Download sequence
Identical sequences G2MGZ7
WP_014051859.1.75361 gi|345005607|ref|YP_004808460.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]