SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345006543|ref|YP_004809396.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345006543|ref|YP_004809396.1|
Domain Number 1 Region: 163-278,306-340
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.45e-26
Family Reductases 0.01
Further Details:      
 
Domain Number 2 Region: 90-171
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.5e-19
Family Ferredoxin reductase FAD-binding domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345006543|ref|YP_004809396.1|
Sequence length 343
Comment oxidoreductase FAD-binding domain-containing protein [halophilic archaeon DL31]
Sequence
MTIRDHNSQHDYADSLPLISKSATVTDVETMDRDRQKEIRTALLELGKDHGFAHAIPTSG
KLDWERIFEAATKASRGLASQIGALHDRFERAHPALLRVVFETDHPFDFAAGQYVSIRYD
GRTRPYSVASSPTRGDTELCIRRVPEGRLSPRLCDELSVGNQITVRGPNGHLLLENPSKR
DIVFVATGTGVAPMKSMIDYSFETGRDEYRGEERDVWLFLGAAWEDDLPYHDAFLELASD
HKNFHYVPCLSREPWLTAWNGETDYIQDALLKYVDERALADAAFGRHMAEMLENRPAVTV
DARIDPGQLEVYACGINAMVYSLETAVQRLGVPDRHVHCEGYG
Download sequence
Identical sequences G2MNP5
WP_014052782.1.75361 gi|345006543|ref|YP_004809396.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]