SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345007412|ref|YP_004810264.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345007412|ref|YP_004810264.1|
Domain Number 1 Region: 1-47
Classification Level Classification E-value
Superfamily PIN domain-like 0.000000421
Family PIN domain 0.012
Further Details:      
 
Domain Number 2 Region: 89-193
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000093
Family Regulator of G-protein signaling, RGS 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345007412|ref|YP_004810264.1|
Sequence length 265
Comment hypothetical protein Halar_0670 [halophilic archaeon DL31]
Sequence
MTRYFVDTNVLIGLTFSHDRWAVEAERILDGHNTLFTSDFVIYEYCSRPQGAPRVVSDPD
QLQVDPDGTGGVFGTVLEDFQENVEDNIPMYNREIDLQRYDGLSFERILEIFFDNIEVRS
QAKPHFVRHFQNYFSSREITPRNAKRCVEDLRDRVLHDAKERKDALMDAVHIMSSTYDDQ
ERARGLVQEHIGIRESRIPPVDSQWLLDAIGLAERDMLQRVVTGDKKDIVRYQQQLASLF
DVSILYILDEFHSHSQAGQGSREVF
Download sequence
Identical sequences B9LVD0 G2MQK0
416348.Hlac_3104 gi|345007412|ref|YP_004810264.1| gi|222476008|ref|YP_002564529.1| gi|345007412|ref|YP_004810264.1|NC_015955 WP_014053518.1.44229 WP_014053518.1.75361 WP_014053518.1.80915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]