SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|530548638|ref|YP_008429180.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530548638|ref|YP_008429180.1|
Domain Number 1 Region: 56-142
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0000562
Family Mitotic arrest deficient-like 1, Mad1 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|530548638|ref|YP_008429180.1|
Sequence length 159
Comment flagellin FlaC [Thermococcus litoralis DSM 5473]
Sequence
MALEFLSSLFSKKKKQPSVSESETEELIDELEERMERREEEEMINQVMERLSEVENEVPR
IKISIDTLKKQFQEVREDIERLEKTIKDIMMLYEVISQEINPFKEQLMQENPLSQELHEV
KQEIESLKMELAQIKNDIRVLAGYGVDIDSIIYDVLSEV
Download sequence
Identical sequences H3ZRC3
WP_004069976.1.73549 gi|530548638|ref|YP_008429180.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]