SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336251621|ref|YP_004598852.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336251621|ref|YP_004598852.1|
Domain Number 1 Region: 64-133
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00000000000306
Family Intron-encoded homing endonucleases 0.013
Further Details:      
 
Weak hits

Sequence:  gi|336251621|ref|YP_004598852.1|
Domain Number - Region: 15-62
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000151
Family FIS-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336251621|ref|YP_004598852.1|
Sequence length 161
Comment HNH endonuclease [Halopiger xanaduensis SH-6]
Sequence
MTNSEYPWRDESLLYELYWEQELSTVEIADKLGCTQQTVSKWMQRFDIPRRDARAAASNQ
RRHPAVFTDRGYIICASNYRGTTDSVGIHRLVMVAERGFDAVADKHVHHKNGVRFDNRPE
NLELLSRSEHAERHGFGSKIKPIDHKWDVSDRERDERGRFK
Download sequence
Identical sequences F8DE42
gi|336251621|ref|YP_004598852.1| WP_013881859.1.76661 gi|336251621|ref|YP_004598852.1|NC_015667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]