SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336252580|ref|YP_004595687.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336252580|ref|YP_004595687.1|
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.64e-32
Family Imidazole glycerol phosphate dehydratase 0.00018
Further Details:      
 
Domain Number 2 Region: 89-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-29
Family Imidazole glycerol phosphate dehydratase 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336252580|ref|YP_004595687.1|
Sequence length 197
Comment Imidazoleglycerol-phosphate dehydratase [Halopiger xanaduensis SH-6]
Sequence
MSERTATVTRETAETAIECTIAIDGDGTAAVDTGIGFFDHMLESVAKHGLFDLEVDCDGD
LEIDDHHTVEDVAIALGQAVDEALGDRSGIVRYADRRVPLDEAVAGAVVDVSGRPRFYFD
GEFSQDSIGGFTSDMARHFAESLAMNAGLTLHLEVTGENAHHEVEALFKALARTLDDATR
LDERREGTPSTKGTLNE
Download sequence
Identical sequences F8DAK3
WP_013878707.1.76661 gi|336252580|ref|YP_004595687.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]