SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336252584|ref|YP_004595691.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336252584|ref|YP_004595691.1|
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.79e-37
Family YigZ N-terminal domain-like 0.00016
Further Details:      
 
Domain Number 2 Region: 140-201
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000101
Family EF-G/eEF-2 domains III and V 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336252584|ref|YP_004595691.1|
Sequence length 202
Comment hypothetical protein Halxa_1179 [Halopiger xanaduensis SH-6]
Sequence
MSRTFETIAEPATAEFVVQGSEFIGHARPVDSVDAAEAFVEEVRAEYDDATHNVPAYRVR
ADADGELLRGYSSDDGEPSGSAGKPALNVLAQRDLENCAVVVTRYFGGTELGVGGLVRAY
SRAVKDAVDAAGVVEERPHERVSIAVEYDDSGTVRGILESEGYEFDADYAADVTFDARVP
LEEADALRDRLRSATSGRVDLE
Download sequence
Identical sequences F8DAK7
gi|336252584|ref|YP_004595691.1| WP_013878711.1.76661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]