SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336252952|ref|YP_004596059.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336252952|ref|YP_004596059.1|
Domain Number 1 Region: 15-196
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.36e-37
Family RNA methyltransferase FtsJ 0.0000652
Further Details:      
 
Domain Number 2 Region: 191-256
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000002
Family TRAM domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336252952|ref|YP_004596059.1|
Sequence length 260
Comment ribosomal RNA large subunit methyltransferase E [Halopiger xanaduensis SH-6]
Sequence
MTGRDHYYNKSKQEGYRSRAAYKLKQLDDLENVIDRGDAVVDLGAAPGGWLQVAAEKVGP
EGRVVGVDLQRIKPFDDDINERVETIRGDMTEERTRDRVIDAAEGKVDAVVSDMAPNMSG
EYSLDQARSLHLARQAFETALELLDTGGDFVVKVFEGPDVDDFRADVEEEFQYVRATSPK
ASRDESSEVYFIAKGRLTAPVRPGDELEVEITDVGNEGDGIASVEGYRLFVPATEEGETV
EVRIDDVKPNFGFAQRIDRD
Download sequence
Identical sequences F8D3F4
WP_013879075.1.76661 gi|336252952|ref|YP_004596059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]