SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336253309|ref|YP_004596416.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336253309|ref|YP_004596416.1|
Domain Number 1 Region: 830-881
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000432
Family Type I dockerin domain 0.0041
Further Details:      
 
Weak hits

Sequence:  gi|336253309|ref|YP_004596416.1|
Domain Number - Region: 695-805
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000628
Family Cellulose-binding domain family III 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336253309|ref|YP_004596416.1|
Sequence length 883
Comment hypothetical protein Halxa_1910 [Halopiger xanaduensis SH-6]
Sequence
MVDFTRRKLMASSVAAAIGTGAVGAATAQDRPDEHDTPLAPYVKGDIKRLSTTAFGAEVT
GPFVFDTGELLYSLQHPSDDNPEPFNHGGVGVIDDFQFTFNGRSDEFDELEPPTDAKGTR
VQSAVGEYRLLVQTGDEINGGTERFGYPQTPDGRSLAEITEPWYEGPGDQPDMNFFVPDE
DEEIEGYLFTNNETRPGAISRTPLYRDEDGYLQADLENAMELENTEPFREIGGTKVNCYG
DLSPWGTPMSSEEEYGHPRVGGLATVGDIVEEGSGVGLRGSSEFWNRPKILAVEQSLEEI
FGEDSWYPMGLHNNRNVEKMAYHLGAEPIDQAGLDEDGVEIDDLARPIDDEEFPNRYRYG
KIVEITEPTADVPTPVKHHVMGRSAWECPEFLSDERTVYLASDGSAKGIYKFVAEKPIPE
YDDRMDVRGTLYAIKAAEVGDGPVAKTDLDVEWLELGTASNAEVESWIAEYDDVTQVDYL
ETHADTDWEEDLEAALREADEEVAKNGNQDYITDEELVEWAKQYEERGPDEVDEELRRVP
FLETRAAAKEIGATIEFNKAEGIDSYDEAEPGDYVYFGISSLSGNMSDDEGELQFDTVAT
GVVYRGELDRNYNVSTLEPVVVGPNEGDAEELMNASLINVDNLMVLDDRRVILCEDKGNF
ARSYTNDTLWVYEPPARVQVDSLAVSHDATGEVDLTLESIPNGIAGGRVTVTVEHDDVAK
ITDASYRDGLELTAEPTVEDGGSTVEFRFADLENEIDADALDVTLATLELEAVGTGTTDI
TIDVHALDDDEGMPVEPQSRPGVVVTGPPAIGGGSGSGSSPTDPDGDGKFEDVNGNGRFD
YDDIVVLFEHLEDDSVQLNEAAYDFNENGRIDYDDVVELYEEL
Download sequence
Identical sequences F8D6F0
WP_013879430.1.76661 gi|336253309|ref|YP_004596416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]