SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336253474|ref|YP_004596581.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336253474|ref|YP_004596581.1|
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.38e-31
Family GHMP Kinase, N-terminal domain 0.0000819
Further Details:      
 
Domain Number 2 Region: 154-285
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 6.78e-26
Family Homoserine kinase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336253474|ref|YP_004596581.1|
Sequence length 293
Comment Homoserine kinase [Halopiger xanaduensis SH-6]
Sequence
MLTVRAPATSANLGSGFDVFGVALGTPADVVRVERAPKTTISVTGAGSEYIPEDPAQNTV
GAVADALDAPARIHIDKGVRPSSGLGSSAASAAAAAVALNDLYDRGYTREELVPIAAEGE
ALVSGEAHADNVAPSLLGGFTIATDDGVTQVDAQIPVVACLPETAVSTRDARDVIPDSAA
LEDVVDTVGNAATLTVGMTRNDPDLVGRGMEDAIVTPKRTSLIDGYEQVRTAALDAGATG
VTVSGAGPGVLAVCHQHDQRAVASAMLEAFEAVGIDSRAYQTRVGEGARLYRE
Download sequence
Identical sequences F8D7X1
WP_013879595.1.76661 gi|336253474|ref|YP_004596581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]