SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336253877|ref|YP_004596984.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336253877|ref|YP_004596984.1|
Domain Number 1 Region: 4-147
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000000106
Family GHMP Kinase, N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336253877|ref|YP_004596984.1|
Sequence length 277
Comment GHMP kinase [Halopiger xanaduensis SH-6]
Sequence
MRDEATAFVPGHITGFFSAHPDEDPTKAGSRGAGLTLTDGVEVTVEPAAGSEPTVVLEGE
EIEVEPVTTVLETLDAPARVEATSDLPLGAGFGVSGALALGTALAANRVFDRKLSMNELV
TIAHGAEVQAGTGLGDVVAQARGGVPIRLEPGGPQDNKLDSIPARARVEYVSFGELSTAD
VLSGDTEQLTEAGTEALSRVVEEPTLLSFMYASRLFAREAELLTERVSETIGDVAAVDGQ
ASMAMLGETVFALGTGLSDAGYEPSVCATHPAGAMLK
Download sequence
Identical sequences F8D8Y8
WP_013879996.1.76661 gi|336253877|ref|YP_004596984.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]