SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336253884|ref|YP_004596991.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336253884|ref|YP_004596991.1|
Domain Number 1 Region: 4-37
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000534
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336253884|ref|YP_004596991.1|
Sequence length 56
Comment hypothetical protein Halxa_2494 [Halopiger xanaduensis SH-6]
Sequence
MKLGTICTTCGERIEENELQYCETCGRGLHEPCREYETTVECRRCGDEQWIGAVEF
Download sequence
Identical sequences F8D8Z0
gi|336253884|ref|YP_004596991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]