SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385803224|ref|YP_005839624.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|385803224|ref|YP_005839624.1|
Domain Number - Region: 12-114
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0531
Family Bacteriorhodopsin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385803224|ref|YP_005839624.1|
Sequence length 157
Comment conserved hypothetical protein [Haloquadratum walsbyi C23]
Sequence
MNTILVISELTVSLRFLLGIIAAAIATIVMNYVMAELPEGNTPPRVAAGVLTMLRPEDAP
RRLAWVVHYVAALLTGPLFVWLIFSVEALLSDTALSVAVSAIILYALMIGFFMIIVLPQS
RVSASRVNTIRRDWALTAGGYLGVLVPLIGGVSLLLS
Download sequence
Identical sequences G0LIF7
gi|385803224|ref|YP_005839624.1| WP_014555631.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]