SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336453779|ref|YP_004608245.1| from Helicobacter bizzozeronii CIII-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336453779|ref|YP_004608245.1|
Domain Number 1 Region: 3-122
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000298
Family IMD domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336453779|ref|YP_004608245.1|
Sequence length 202
Comment hypothetical protein HBZC1_15470 [Helicobacter bizzozeronii CIII-1]
Sequence
MQEVLEKLEQEVKSAKRACRLAKSVLEEGLDAGAEAKDLHAKFSALVGALTHLSQALENH
YASLEDDTELEKVLILFKRLRAKINTPLASLEQVSTAKEVLDSLASLEKSVFDLEGVLMA
LKEHPALSAPTTTKATPKMAKKYCPQSKEELKKLVADESVHLGEIDISKIADLSFVFSHA
TGGGGGTKTMQSNPLPAKTLRA
Download sequence
Identical sequences F8KP28
gi|336453779|ref|YP_004608245.1| WP_013890933.1.34921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]