SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336452810|ref|YP_004607276.1| from Helicobacter bizzozeronii CIII-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|336452810|ref|YP_004607276.1|
Domain Number - Region: 71-212
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000785
Family FCH domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336452810|ref|YP_004607276.1|
Sequence length 573
Comment hypothetical protein HBZC1_05780 [Helicobacter bizzozeronii CIII-1]
Sequence
MVFFVGGRFGVSSESPSYKQNTPTSAGATRSVSATELSQDAKQDIQNALQLLKNLNGSLV
RAAGSNQDLNSLSSISLSSLNGMRALQANIANILQHLQAAIDNSTNNGQNQAIMSQYRAI
VNELQTLQTQVTQEVNNYNQELNSQKQNYDTKHAAYQKAEQEYQGKVQAYNTARDSVTNI
INNAPSMTCGFNAGCSSNQLTTFLNDTAALVHDLQILAPLNPKFSQNNPQQNYNNAYSSG
YNQAVDIPTLESKLIFSANDAANYFISHLQQLGMYPNLLTQANLNLSNFISLAAWFNHQA
DIIEALKYSHPTQFSNYMQGLYTSFHSVFQDFTLNPSFLNDAVPPATTALGNGPQFSLSN
QFNFPYQNFAPQIQATYHQLNAIPNIALPHTIQIKPSLAPIAKGINQSSSLFSNISYNVD
LLAGYQYFFSGHFGFSFHVSVGYGYIHSPIFNSLSFFKHLQDIKINLGADLIYDFNTPTD
YKSPVYYGVFAGVQGGNTNFVLNTNNRALWRASYNLGLDLGLRFQFSSNIIKVGVDIPLV
PYKVNWQTDLGSFQLNRSAKDIGFFITYEKLIF
Download sequence
Identical sequences F8KS14
WP_013890037.1.34921 gi|336452810|ref|YP_004607276.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]