SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA01G0051500.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA01G0051500.1
Domain Number 1 Region: 204-441
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-77
Family SSRP1-like 0.00000644
Further Details:      
 
Domain Number 2 Region: 543-624
Classification Level Classification E-value
Superfamily HMG-box 6.68e-26
Family HMG-box 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA01G0051500.1
Sequence length 641
Comment pep:known scaffold:1.0:Oglab01_0024:88502:94569:1 gene:ORGLA01G0051500 transcript:ORGLA01G0051500.1
Sequence
MTDGHLFNNILLGGRAGSNPGQFKVYSGGLAWKRQGGGKTIEIEKSDLTSVTWMKVPRAY
QLGVRTKDGLFYKFIGFREQDVSSLTNFMQKNMGLSPDEKQLSVSGQNWGGIDINGNMLT
FMVGSKQAFEVSLADVSQTQMQGKTDVLLEFHVDDTTGGNEKDSLMDLSFHVPTSNTQFL
GDENRTAAQVLWETIMGVADVDSSEEAVVTFEGIAILTPRGRYSVELHLSFLRLQGQAND
FKIQYSSIVRLFLLPKSNNPHTFVVVTLDPPIRKGQTLYPHIVIQFETEAVVERNLALTK
EVLAEKYKDRLEESYKGLIHEVFTKVLRGLSGAKVTRPGSFRSCQDGYAVKSSLKAEDGL
LYPLEKGFFFLPKPPTLILHEEIEFVEFERHGAGGASISSHYFDLLVKLKNDQEHLFRNI
QRSEYHNLFNFINGKHLKIMNLGDGQGATGGVTAVLRDTDDDAVDPHLERIKNQAGDEES
DEEDEDFVADKDDSGSPTDDSGGEDSDASESGGEKEKLSKKEASSSKPPVKRKPKGRDEE
GSEKRKPKKKKDPNAPKRAMTPFMYFSMAERGNMKNNNPDLPTTEIAKKLGEMWQKMTGE
EKQPYIQQSQVDKKRYEKESAVYRGAAAMDVDSGSGGNESD
Download sequence
Identical sequences A0A0D3EKF8 A0A0D9Y498 A0A0E0BYC7 A0A0E0FHA5 B8ADM5 I1NKX5
OGLUM01G06010.1 OGLUM01G06010.2 OGLUM01G06010.3 OBART01G05540.1 ONIVA01G06280.1 ORGLA01G0051500.1 OMERI01G05800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]