SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA02G0220100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA02G0220100.1
Domain Number 1 Region: 150-205
Classification Level Classification E-value
Superfamily HMG-box 0.0000000471
Family HMG-box 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA02G0220100.1
Sequence length 256
Comment pep:known scaffold:1.0:Oglab02_0283:9831:12049:-1 gene:ORGLA02G0220100 transcript:ORGLA02G0220100.1
Sequence
MSSSSSSSAVFPLDHLAAPSPTEQLCYVHCNCCDTILAVGVPCSSLFKTVTVRCGHCANL
LSVNLRGLLLPAPAPAPANQLHFGPSLLSPTSPHGLLDEVAFQTPSLLMEQAASASLSSI
TGRSSSSCASNAPAMQMPPAKPVQQEPELPKNAPASANRPPEKRQRVPSAYNRFIKDEIQ
RIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQGFKKTFKPQDGSEDILLKDSLYAA
AAAAAAAAANMGVTPF
Download sequence
Identical sequences A0A0D3F851 A0A0D9YVL2 A0A0E0CP17 A0A0E0GAC6 A2X7Q3 I1P2J5 Q6H668
OGLUM02G26190.1 OMERI02G24350.1 LOC_Os02g42950.1|PACid:21920596 ORGLA02G0220100.1 OBART02G25670.1 ONIVA02G28110.1 LOC_Os02g42950.1|13102.m04762|protein XP_015622736.1.37577 39947.LOC_Os02g42950.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]