SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA04G0171000.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA04G0171000.1
Domain Number 1 Region: 160-211
Classification Level Classification E-value
Superfamily HMG-box 0.000000262
Family HMG-box 0.0074
Further Details:      
 
Weak hits

Sequence:  ORGLA04G0171000.1
Domain Number - Region: 32-75
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0578
Family Transcriptional factor domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA04G0171000.1
Sequence length 261
Comment pep:known scaffold:1.0:Oglab04_0270:3547:5591:-1 gene:ORGLA04G0171000 transcript:ORGLA04G0171000.1
Sequence
MMSSAPETFSLDHLSQHQQQQPPPLAEQEQLCYVHCNFCDTILAVGVPCSSLFKTVTVRC
GHCANLLSVNLRGLLLPAAASTANQLPFGQALLSPTSPHGLLDEVPSFQAPASLMTEQAS
PNVSSITSSNSSCANNAPATSMASAANKATQREPQQPKNAPSANRTSEKRQRVPSAYNRF
IKDEIQRIKASNPDITHREAFSAAAKNWAHFPHIHFGLMPDQGLKKTGIQSQDGAGECML
FKDGLYAAAATAASSMGVTPF
Download sequence
Identical sequences I1PNE1
ORGLA04G0171000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]