SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA04G0188600.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA04G0188600.1
Domain Number 1 Region: 14-75
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000111
Family HMG-box 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA04G0188600.1
Sequence length 147
Comment pep:known scaffold:1.0:Oglab04_0286:13500:16151:1 gene:ORGLA04G0188600 transcript:ORGLA04G0188600.1
Sequence
MGKADADAEFKAAGKRKKAGGAGKPKRGLTPFFAFLAEFRPQYMEKHPNTKGVAAVTKAA
GEKWRAMSDEEKAQYGGKKPDGESKPAAASKKKESTSSKKAKTDGAEQEGEGSDKSKSDV
EDDENDGSGEVYRTLYSTWRCLALKWK
Download sequence
Identical sequences A0A0E0H4E8 I1PNW7
LOC_Os04g47690.1|PACid:21891661 LOC_Os04g47690.1|13104.m04839|protein ORGLA04G0188600.1 ONIVA04G20340.2 39947.LOC_Os04g47690.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]