SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA05G0037800.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA05G0037800.1
Domain Number 1 Region: 115-208
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000477
Family 7-Fe ferredoxin 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA05G0037800.1
Sequence length 410
Comment pep:known scaffold:1.0:Oglab05_0008:502466:505872:-1 gene:ORGLA05G0037800 transcript:ORGLA05G0037800.1
Sequence
PPPPPPRLLLASHAAVRAAASARRGRLAGDHHPPQVAALRRGDWVKLICGASFEDAADVR
NLSLVYTLAGVDCIDCAADASVVGAVNEGIDVAASIVPSVQSPWVMVSVNDDCRDLHFRK
AEFDPEDCPPDCSKPCEKVCPADAISLERVMIEGKHSQSDPSSGKLEGGVITERCYGCGR
CLSVCPYDRIRAMSYVRDPTKTAELLKRNDVDAIEIHTTGKGTDMFNTLWSNLGDSINNV
KLIAVSLPDVGDSTVNFMNAIYTTMQSHLQGYNLWQLDGRPMSGDIGRGATRETVSFAVH
LSSMSNRPPGFYQLAGGTNSYTIESLKKAGLFQSTTFAATSGVTDCQQAFIGGIAYGGYA
RKIVGRVLRKIPAQFGHARIEDHPDYLLEALQEALSLVGPVKGYPTLPSL
Download sequence
Identical sequences I1PSN0
ORGLA05G0037800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]