SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA05G0049600.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA05G0049600.1
Domain Number 1 Region: 204-440
Classification Level Classification E-value
Superfamily PH domain-like 2.7e-76
Family SSRP1-like 0.00000902
Further Details:      
 
Domain Number 2 Region: 544-626
Classification Level Classification E-value
Superfamily HMG-box 6.02e-24
Family HMG-box 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA05G0049600.1
Sequence length 640
Comment pep:known scaffold:1.0:Oglab05_0009:492327:497368:1 gene:ORGLA05G0049600 transcript:ORGLA05G0049600.1
Sequence
MTDGHHFNNISLGGRGGNNPGQFKLYSGGLAWKRQGGGKTIEVEKSDITSVTWMAIPRSY
QLGVSTKEGLFYRFFGFREQDISSLTNFMEKNMRITPEEKQLSVGGHNWGGIEINGNMLS
FNVGSKEAFEVSLADVAQTQMQGKTDVVLEFHVDDTTGGNEKDSLMDLSFHVPTSNTQFP
GDENRPSAQVLWQAILNKADVGSSEEAVVTFDGIAILTPRGRYSVELHLSFLRLQGQAND
FKIQYSSILRLFVLPKSNNPHTFVVITLDPPIRKGQTLYPHIVIQFETEAVVQRDLTLSD
EVLAEKYKDRLENSYQGLIHEVFSKVLRGLSGAKVTRPSTFRSCQDGYAVKSSLKAEDGL
LYLLEKGFFFLPKPPTLILHEEIEYVEFERHGAGGASISSHYFDLLVKLKNDQEHLFRNI
QRNEYHNLFNFISGKHLKILNLGEAQGRAGGVTAVLQSTDDDAVDPHLERIRNQTGDDES
DEEDEDFVADKDDSGSPTDDSGEEGSDASLSGGEKEKSSKKEASSSKAPLKKRKPKGGDA
AEGSEKRKPKKKKDPNAPKRAIAPFMYFSKAERANLKNSNPELATTEIAKKLGERWQKMT
AEEKQPYVEQSQVDKKRYAEESAAYRGAAAMDVDSGPASD
Download sequence
Identical sequences I1PSZ8
ORGLA05G0049600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]