SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA06G0238300.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA06G0238300.1
Domain Number 1 Region: 28-112
Classification Level Classification E-value
Superfamily HMG-box 1.17e-24
Family HMG-box 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA06G0238300.1
Sequence length 157
Comment pep:known scaffold:1.0:Oglab06_0239:166436:167747:1 gene:ORGLA06G0238300 transcript:ORGLA06G0238300.1
Sequence
MKGAKSKGAAKPDAKLAVKSKGAEKPAAKGRKGKAGKDPNKPKRAPSAFFVFMEEFRKEF
KEKNPKNKSVAAVGKAAGDRWKSLTEADKAPYVAKANKLKAEYNKAIAAYNKGESTAKKA
PAKEEEEDDEEESDKSKSEVNDEDDDEGSEEDEDDDE
Download sequence
Identical sequences A0A0D3GL26 A0A0E0E6M1 A0A0E0Q2W2 I1Q5H0 Q5Z7N3 Q8H6F1 Q9ZSU6
39947.LOC_Os06g51220.2 ORGLA06G0238300.1 OBART06G28090.2 LOC_Os06g51220.2|PACid:21930934 LOC_Os06g51220.3|PACid:21930935 LOC_Os06g51220.4|PACid:21930936 OMERI06G26430.2 LOC_Os06g51220.2|13106.m05519|protein LOC_Os06g51220.3|13106.m05520|protein LOC_Os06g51220.4|13106.m05521|protein XP_015643271.1.37577 XP_015643272.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]