SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA07G0250200.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA07G0250200.1
Domain Number 1 Region: 106-159
Classification Level Classification E-value
Superfamily HMG-box 0.0000000982
Family HMG-box 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA07G0250200.1
Sequence length 169
Comment pep:novel scaffold:1.0:Oglab07_unplaced150:282964:283994:1 gene:ORGLA07G0250200 transcript:ORGLA07G0250200.1
Sequence
MSSAARHHCSGLRERLGCVQCSFCATVLLVSVPCSSVLRVVAVQCGHCSGILSAVNLPPS
PVSASIELTPQELDAGPPPGEYSDESSGDDREGRDAEDDAPAPAAAAVANKPPGRKQRTP
SAYNCFVKEEIKRIKSMEPNITHKQAFSTAAKNWAHLPRIQQKRGRDSC
Download sequence
Identical sequences A2PZN8 I1QEG0
LOC_Os07g38410.1|PACid:21898524 LOC_Os07g38410.1|13107.m03972|protein XP_015647119.1.37577 ORGLA07G0250200.1 39947.LOC_Os07g38410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]